Respondida
How to do numerical multiple integral (more than triple) by using matlab?
You can eliminate the variables one by one until you feel comfortable. You can make down to 3 or 2 or 1 variable before final in...

casi 12 años hace | 1

Respondida
Matlab Triple Integration Error. Thank You
Replace out2 by out2 = integral3(yi, 0, Inf , 0, @(u3) u3 , 0, @(u3,u2) u2) If you want to use function handles as the ...

casi 12 años hace | 1

| aceptada

Respondida
Randomly create lower and upper of matrix separately.
l = tril(rand(m,n),-1); % lower triangle u = triu(rand(m,n),1); % upper triangle d = diag(rand(1,m),0); % diagonal eleme...

casi 12 años hace | 2

| aceptada

Respondida
How to rotate cube in MATLAB.?
Add the following lines of code at the bottom of your code: roll = -0.3064; pitch = -1.2258; yaw = 9.8066; dcm = angle2d...

casi 12 años hace | 2

| aceptada

Respondida
How can i change values for my data in plot axis?
Replace t in plot by t/3600, that converts t from second to hour Add a text command with appropriate coordinate of the locati...

casi 12 años hace | 2

| aceptada

Respondida
comparing matrix elements in order
A = [2000 500 300 300 1]'; A1 = sort(A,'descend'); if sum(A==A1)==length(A) disp('in order') else disp('not in...

casi 12 años hace | 2

| aceptada

Resuelto

Make one big string out of two smaller strings
If you have two small strings, like 'a' and 'b', return them put together like 'ab'. 'a' and 'b' => 'ab' For extra ...

casi 12 años hace

Resuelto

Determine whether a vector is monotonically increasing
Return true if the elements of the input vector increase monotonically (i.e. each element is larger than the previous). Return f...

casi 12 años hace

Respondida
the number of occurences of each character of one string,in another
s = 'MEQNGLDHDSRSSIDTTINDTQKTFLEFRSYTQLSEKLASSSSYTAPPLNEDGPKGVASAVSQGSESVVSWTTLTHVYSILGAYGGPTCLYPTATYFLMGTSKGCVLIFNYNEHLQTILVP...

casi 12 años hace | 1

Respondida
Constructing an approximate periodical function x(t) giving its Fourier series coefficient?
You can use a vectorized code to get the periodic signal: f0 = 1; % set the frequency of desired signal t = 0:0.01:8; ...

casi 12 años hace | 1

Respondida
Confusion Matrix Results Issue
The input arguments of confusion, (in this case, outputs and predictedOutput) should be in range of [0 1]. So, instead of 100 an...

casi 12 años hace | 1

| aceptada

Respondida
how to sparse represent a image?
Convert a to double first, and the use that in sparse. Make sure that a is not in 3D, if so, then make it 2D before using in spa...

casi 12 años hace | 2

| aceptada

Respondida
error with gmail sending
Make sure you are using some lines of code before using sendmail function: UserName = 'yourmail@gmail.com'; passWord = '...

casi 12 años hace | 2

Respondida
matrix operaions sums multiplications
It seems that A(:,3:end) are never used. If that is the case, then you can simply use a for loop: for k = 1:size(B,1) ...

casi 12 años hace | 1

Respondida
Selection of priority data
data=[3;4;8;NaN;NaN;NaN;7;4;3;NaN;NaN;2;3;NaN;9]; findNaN = find(isnan(data)); first = findNaN(1); numb...

casi 12 años hace | 1

| aceptada

Respondida
selecting the last 60 rows in a matrix with an uncertain number of rows
last60rows = a(end-59:end,:)

casi 12 años hace | 2

| aceptada

Respondida
I wanna define function which has flexible number of argument.
function out = F(varargin) % do stuffs % y = varargin{1}+varargin{2} % out = y+1; etc. For flexible number of...

casi 12 años hace | 1

| aceptada

Respondida
Element to element Array Multiplication with all answers.
c = bsxfun(@times,a,B1) out = sum(c,2)

casi 12 años hace | 1

| aceptada

Respondida
GUI I want to take datas from a struct into my listbox
There are multiple ways to do so. One of them: I assume you have a pushbutton to display in the names in the listbox. And if so,...

casi 12 años hace | 1

| aceptada

Respondida
How to get only those output values which lie under a given curve!
Perhaps, you unconsciously mistyped the x coordinate of third point. I use 3800 instead of 2100, but use what the actual value i...

casi 12 años hace | 1

| aceptada

Respondida
find power of signal
In time domain: for discrete signal x(n) Instantaneous power = |x(n)|^2 Average power = (1/N) * sum(|x(n)|.^2) N = data...

casi 12 años hace | 2

| aceptada

Respondida
Image types and matrix multiplication
I guess I=Lena? And, T = load('Wav.mat'); % the .mat file you uploaded T1 = T.T1; ? If yes, then replace inverse ...

casi 12 años hace | 1

Respondida
Cumnwise multiplication between a matrix and a vector.
A = [1 2 3; 7 2 4; 2 0 4] B = [1 2 3] C = bsxfun(@times,A,B)

casi 12 años hace | 1

| aceptada

Respondida
How to concatenate string vectors of unequal length?
v1 = {'a' 'b' 'c'}'; v2 = {'d'}'; v3 = {'e' 'f'}'; Lv1 = length(v1); Lv2 = length(v2); Lv3 = length(v3); n = max([...

casi 12 años hace | 1

Respondida
How to clear data from plot in matlab GUI, but then re-plot it without re-running the GUI
Use cla under the Callback function of your button. Don't use *clear all* command, as it clears all variables. Examples: cl...

casi 12 años hace | 2

Respondida
I have a circuit that I want to gain its transfer function.I've attached a JPG file.
Input voltage (across left C) = Vi Output voltage (across right C) = Vo Apply voltage divider rule in RL and C (at right) ...

casi 12 años hace | 1

| aceptada

Respondida
Finding peaks in data based on certain threshold
Once I had to write a function for this type of problem in on of my projects. Seeing your question here, I have uploaded that fi...

casi 12 años hace | 2

| aceptada

Respondida
How can I substitute a variable?
a= 5; syms x y = a*sin(x).^2 ./(sin(x) + cos(x)); subs ( y,{x},{2} )

casi 12 años hace | 1

Respondida
Count the index of the array
A=[0 0 0 0 0 0 0 0 0 10 0 0 0 0 15 0 17]; sum(A>0)

casi 12 años hace | 2

Respondida
integration of FFT
K_fourier is double type in your code. int cannot take double type as the function. @ Thorsten: int performs all symbolic, de...

casi 12 años hace | 1